"context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" { "action" : "rerender" "action" : "rerender" { ', 'ajax'); ] { { "useSimpleView" : "false", "event" : "approveMessage", "event" : "MessagesWidgetMessageEdit", } } "action" : "rerender" "kudosLinksDisabled" : "false", { "action" : "rerender" "; Execute whatever should happen when entering the right sequence "revokeMode" : "true", ], "kudosLinksDisabled" : "false", }, > 0) ) "context" : "lia-deleted-state", }, { "actions" : [ "event" : "addThreadUserEmailSubscription", { } "dialogKey" : "dialogKey" } }, { element.find('ul').slideUp(); "displaySubject" : "true", { // Oops. ] LITHIUM.AjaxSupport.ComponentEvents.set({ // console.log('watching: ' + key); }, "event" : "markAsSpamWithoutRedirect", "disableKudosForAnonUser" : "false", "}); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "includeRepliesModerationState" : "false", "context" : "envParam:feedbackData", } { "action" : "rerender" { } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "envParam:quiltName,message", "disableLabelLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); } LITHIUM.AjaxSupport.ComponentEvents.set({ } LITHIUM.AjaxSupport.ComponentEvents.set({ ] { "action" : "rerender" "action" : "rerender" ] }, Bist du sicher, dass du fortfahren möchtest? { "event" : "approveMessage", } "event" : "AcceptSolutionAction", "componentId" : "kudos.widget.button", ] { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234035}); "event" : "QuickReply", "displayStyle" : "horizontal", { "context" : "", })(LITHIUM.jQuery); "event" : "AcceptSolutionAction", "action" : "rerender" "action" : "rerender" { "event" : "expandMessage", "event" : "addMessageUserEmailSubscription", o.innerHTML = ""; var msg = $(".message-uid-2498944"); "event" : "addMessageUserEmailSubscription", }, "disableLinks" : "false", "selector" : "#kudosButtonV2_6", "context" : "", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"kBi6K7UNoudFVTsfi3sJ-69Cmy5VLi0NNPaEiIhtEYY. "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ "context" : "", { "context" : "", } "action" : "rerender" } }, "actions" : [ { "context" : "", "action" : "rerender" "actions" : [ ] ] // Oops, not the right sequence, lets restart from the top. { { "event" : "deleteMessage", } "event" : "AcceptSolutionAction", "truncateBody" : "true", "context" : "", watching = true; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "actions" : [ $(this).toggleClass("view-btn-open view-btn-close"); { "dialogKey" : "dialogKey" }, })(LITHIUM.jQuery); // Pull in global jQuery reference "useCountToKudo" : "false", "context" : "", "displaySubject" : "true", "action" : "rerender" "context" : "", "action" : "rerender" }, { } "actions" : [ }, { "context" : "", "action" : "rerender" }, ] LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "message" : "1712869", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "event" : "RevokeSolutionAction", "actions" : [ })(LITHIUM.jQuery); document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); }, "action" : "rerender" { ] } "event" : "deleteMessage", "event" : "MessagesWidgetMessageEdit", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qhVtK7u_lOIBbkKNnowOCkKQNatBWsS-smY5LxwomnM. LITHIUM.Dialog.options['-16529610'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "context" : "", "context" : "", }, { })(LITHIUM.jQuery); "actions" : [ }, }, ] "context" : "envParam:quiltName,message", "accessibility" : false, ] "event" : "MessagesWidgetEditCommentForm", ] } { "disableLabelLinks" : "false", ] "action" : "pulsate" Did this solve the problem? { } { Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" { "context" : "", "event" : "MessagesWidgetCommentForm", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); { "action" : "pulsate" "action" : "rerender" ] { } "actions" : [ } } LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" $('.css-menu').removeClass('cssmenu-open') { } "event" : "RevokeSolutionAction", "useTruncatedSubject" : "true", { // --> ] "dialogContentCssClass" : "lia-panel-dialog-content", "actions" : [ "showCountOnly" : "false", } "truncateBodyRetainsHtml" : "false", ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1712867 .lia-rating-control-passive', '#form_6'); "action" : "rerender" } } }, $('#vodafone-community-header .lia-search-toggle').click(function() { } "kudosable" : "true", "event" : "ProductMessageEdit", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); } "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" "initiatorBinding" : true, } { { } { ] ] "event" : "kudoEntity", ] LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "initiatorBinding" : true, ;(function($) { } } }, { "useTruncatedSubject" : "true", "event" : "deleteMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, '0b1C4HKRBmaErbLmgz1LD3tUcaONGmakXMb5dl6bDkc. "context" : "", }, { "actions" : [ "action" : "rerender" ] { "context" : "envParam:quiltName", setWarning(pagerId); { "action" : "rerender" }, "context" : "envParam:selectedMessage", "closeEvent" : "LITHIUM:lightboxCloseEvent", return; lithadmin: [] "event" : "addMessageUserEmailSubscription", "context" : "", "kudosLinksDisabled" : "false", ] "componentId" : "forums.widget.message-view", "kudosable" : "true", ] "event" : "ProductAnswerComment", { "includeRepliesModerationState" : "false", "event" : "kudoEntity", { $(this).toggleClass("view-btn-open view-btn-close"); }, { }); "context" : "", "context" : "envParam:quiltName", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "event" : "MessagesWidgetAnswerForm", "action" : "rerender" }, { "event" : "RevokeSolutionAction", { "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:quiltName", } "displayStyle" : "horizontal", "disableLinks" : "false", "linkDisabled" : "false" { element.children('ul').slideDown(); "actions" : [ ], { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); { "context" : "", "useCountToKudo" : "false", "event" : "ProductMessageEdit", { { })(LITHIUM.jQuery); } "disableLinks" : "false", "event" : "QuickReply", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "revokeMode" : "true", { ] ] "message" : "1712912", lithstudio: [], ] "event" : "removeMessageUserEmailSubscription", "event" : "addThreadUserEmailSubscription", "useCountToKudo" : "false", { "event" : "kudoEntity", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pyDDJTHg7X5rV2Joy2uPDB2etgIH-yB86IUx-96zHCY. ] { "componentId" : "kudos.widget.button", } "eventActions" : [ "message" : "1712247", }, "context" : "envParam:feedbackData", } "parameters" : { } }, "actions" : [ }); }, } LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2498944}},{"elementId":"link_9","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2511446}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512465}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542477}},{"elementId":"link_12","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542074}},{"elementId":"link_13","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2541721}},{"elementId":"link_15","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542790}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542392}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542074}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2541878}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2541721}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2541417}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2541377}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2541261}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2540876}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2540510}}]); { "context" : "lia-deleted-state", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", }, { { "actions" : [ }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", // enable redirect to login page when "logmein" is typed into the void =) LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "context" : "", }, "action" : "rerender" "context" : "", "action" : "rerender" "action" : "addClassName" "context" : "", { "action" : "rerender" }, }, } ;(function($) { ] ] { "context" : "envParam:quiltName", }; "message" : "1712247", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] }, if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "action" : "rerender" ] { "action" : "rerender" } }, ] "event" : "MessagesWidgetEditAction", ] } createStorage("false"); }, ] "actions" : [ "actions" : [ "actions" : [ "event" : "ProductAnswerComment", setCookie: function(cookieName, cookieValue) { "context" : "envParam:quiltName,message", "context" : "", { "context" : "", "event" : "removeMessageUserEmailSubscription", } }, } }, "event" : "MessagesWidgetMessageEdit", "actions" : [ } "forceSearchRequestParameterForBlurbBuilder" : "false",