"actions" : [ { } "parameters" : { ] }, "actions" : [ { } }); { o.innerHTML = "Page number must be 1 or greater. { } "action" : "rerender" $('#community-menu-toggle').click(function() { "includeRepliesModerationState" : "false", Ich habe mich nun 9x ohne Probleme hintereinander in EFT einloggen können. "action" : "pulsate" // Oops. return; "actions" : [ document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "actions" : [ ] "context" : "envParam:selectedMessage", "action" : "rerender" return; "showCountOnly" : "false", "event" : "addThreadUserEmailSubscription", return false; }, Wir haben den MTU Wert der Clients von 1500 auf 1300 reduziert, dies half. "context" : "envParam:entity", "action" : "rerender" { } "action" : "pulsate" "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/122274","ajaxErrorEventName":"LITHIUM:ajaxError","token":"VI6ZDn-Z45gorYa7G7uRhbmy2vwosX3Bql2gXdi4lqE. { "actions" : [ "context" : "", "action" : "addClassName" "action" : "rerender" }, }, { "action" : "rerender" }, "disableLinks" : "false", "action" : "rerender" "componentId" : "forums.widget.message-view", "context" : "", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/122274","ajaxErrorEventName":"LITHIUM:ajaxError","token":"E71toRo0qEuhlJHJlupF1KsedR-W4XwQwzDRM6W3ygQ. ], "kudosable" : "true", }, }, } LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { ] } "disableLinks" : "false", "event" : "ProductAnswerComment", ] "kudosLinksDisabled" : "false", "event" : "MessagesWidgetEditCommentForm", "actions" : [ "event" : "addThreadUserEmailSubscription", } Execute whatever should happen when entering the right sequence "action" : "addClassName" { } ], { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "event" : "deleteMessage", "actions" : [ "actions" : [ }, "eventActions" : [ } "event" : "ProductMessageEdit", { "revokeMode" : "true", "event" : "removeThreadUserEmailSubscription", "event" : "RevokeSolutionAction", "actions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", ] "context" : "", "actions" : [ } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "disableLinks" : "false", { "actions" : [ "event" : "expandMessage", { }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/122274","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-w2UmjceFtKWzlLBzG8yUyLlZa2JV0Ox80h1XsrlQKE. { "context" : "", function clearWarning(pagerId) { ] LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "action" : "rerender" ], }); "event" : "approveMessage", "context" : "", "context" : "envParam:quiltName", window.scrollTo(0,position_x.top - 150); "context" : "", "event" : "QuickReply", "action" : "rerender" "action" : "pulsate" }, }, "displaySubject" : "true", "action" : "addClassName" }); "useSubjectIcons" : "true", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); }, "actions" : [ "event" : "removeMessageUserEmailSubscription", "context" : "", Massive Probleme bei Vodafone: Infos und mögliche Lösung (Update 2) Problem, Störung, Verkehrsschild Bildquelle: Pixabay Aktuell melden Kunden von Vodafone , … { { { "actions" : [ "; "context" : "envParam:quiltName,message", }, "displaySubject" : "true", }, "event" : "approveMessage", "disallowZeroCount" : "false", ] } "actions" : [ { "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "pulsate" { "context" : "", "action" : "rerender" }, { clearWarning(pagerId); watching = false; LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetCommentForm", { ] LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "parameters" : { "action" : "rerender" ] } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { "actions" : [ "actions" : [ Press the WLAN button in the HG659 to enable or disable the … "context" : "", } LITHIUM.Dialog.options['1526216478'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] { { "; }, "showCountOnly" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:entity", "useCountToKudo" : "false", "actions" : [ "event" : "ProductMessageEdit", }, { return; "event" : "MessagesWidgetEditAction", { "parameters" : { LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "actions" : [ { "kudosLinksDisabled" : "false", { "useTruncatedSubject" : "true", } } "context" : "lia-deleted-state", { "message" : "2228895", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "context" : "envParam:selectedMessage", } "context" : "envParam:feedbackData", ] } "action" : "rerender" "componentId" : "forums.widget.message-view", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/122274","ajaxErrorEventName":"LITHIUM:ajaxError","token":"VI6ZDn-Z45gorYa7G7uRhbmy2vwosX3Bql2gXdi4lqE. "action" : "pulsate" "action" : "rerender" "context" : "envParam:selectedMessage", "action" : "rerender" { count++; "actions" : [ { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'fhnq3pVjSx2Di9RC4v7BSS5lIvN-nZJzeCxin5qxAQI. "displayStyle" : "horizontal", { "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "addClassName" "disallowZeroCount" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "RevokeSolutionAction", "context" : "", $(document).ready(function(){ ] "disableKudosForAnonUser" : "false", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { function processPageInputBlur(pagerId, val) "quiltName" : "ForumMessage", { "action" : "rerender" "action" : "pulsate" ] }, { }, "action" : "rerender" } }); "action" : "rerender" LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "truncateBody" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" return; } } } else { "context" : "", }); "context" : "envParam:entity", { "actions" : [ { }, "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.AjaxSupport.ComponentEvents.set({ function setWarning(pagerId) { "context" : "envParam:feedbackData", { "action" : "rerender" }, "displaySubject" : "true", "actions" : [ ] "event" : "markAsSpamWithoutRedirect", ] { clearWarning(pagerId); }, "event" : "AcceptSolutionAction", ], count = 0; { ] ] "event" : "MessagesWidgetMessageEdit", "event" : "ProductAnswer", "actions" : [ // console.log(key); "initiatorDataMatcher" : "data-lia-message-uid" "event" : "removeThreadUserEmailSubscription", "context" : "envParam:quiltName,product,contextId,contextUrl", watching = true; ;(function($) { "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName", { } "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "disableLabelLinks" : "false", { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "useSubjectIcons" : "true", "context" : "", "actions" : [ ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); } }, o.innerHTML = "Page number can\'t exceed 2. { "actions" : [ "context" : "", }, Zudem werden Privatanschlüsse bei VF KD und UM nur noch mit DS-Lite aufgrund der IPv4 Adressknappheit geschalten. "event" : "ProductAnswer", "event" : "ProductAnswer", } "event" : "unapproveMessage", { "event" : "MessagesWidgetCommentForm", "actions" : [ "actions" : [ { "actions" : [ "action" : "rerender" }, "context" : "", "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" }, ] { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "useCountToKudo" : "false", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "actions" : [ o.innerHTML = "Page number can\'t exceed 2. "actions" : [ "context" : "envParam:selectedMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'fhnq3pVjSx2Di9RC4v7BSS5lIvN-nZJzeCxin5qxAQI. } ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "parameters" : { ] { "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", ] { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "addThreadUserEmailSubscription", } "actions" : [ "event" : "markAsSpamWithoutRedirect", Naja Fritzboxen sind generell halt recht schwach. { } "action" : "rerender" { "action" : "rerender" "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2233224,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "quiltName" : "ForumMessage", "actions" : [ })(LITHIUM.jQuery); "action" : "rerender" { { { "event" : "editProductMessage", }, ] } }, "action" : "rerender" "action" : "pulsate" "useSimpleView" : "false", "event" : "AcceptSolutionAction", "actions" : [ "action" : "pulsate" }, } return false; }, } { "actions" : [ count = 0; }, "action" : "rerender" ] }); "event" : "MessagesWidgetEditAction", "componentId" : "forums.widget.message-view", { }, { }, "kudosable" : "true", { ;(function($) { "context" : "envParam:quiltName", LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'M7rOLtvhd26LXG_wyW7xs4vFV0G-bhOGgn67zg8Wd3c. { "context" : "envParam:selectedMessage", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { "actions" : [ "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", }, { Das Technicolor ließ sich dann am nächsten morgen auch in den Bridge mode umschalten. ] "actions" : [ "action" : "rerender" }, { "action" : "rerender" "action" : "rerender" "action" : "rerender" "eventActions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "actions" : [ { "useSubjectIcons" : "true", "action" : "rerender" "context" : "", ] "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ } "}); { "entity" : "2232483", { "event" : "kudoEntity", } }, "showCountOnly" : "false", "event" : "kudoEntity", "event" : "deleteMessage", $(document).ready(function(){ "actions" : [ "context" : "", ], "action" : "rerender" "parameters" : { ', 'ajax'); LITHIUM.AjaxSupport.ComponentEvents.set({ }, { > 0) ) "actions" : [ }, { "context" : "", "showCountOnly" : "false", ] "action" : "rerender" ], "componentId" : "kudos.widget.button", "context" : "", "actions" : [ "action" : "rerender" "context" : "", "action" : "rerender" { { "kudosable" : "true", $(document).ready(function(){ { "componentId" : "kudos.widget.button", setWarning(pagerId); }, ] disableInput(pagerId); } "componentId" : "kudos.widget.button", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2228370 .lia-rating-control-passive', '#form_2'); // Oops. "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" { "action" : "rerender" "defaultAriaLabel" : "", "useSubjectIcons" : "true", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1213,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlABC1dUD10MCxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUAAAQAAVdQBRQBVVcESQEFBwVIVAUBBk9TBAENBlZQBwQFCgFAThUPVn1bVgB\/AhsIQCtZEFBBWlcRGyNXVgUHRQVQR1EQSRQNWmAHEUMyB2JBVxdPRAMQMSd7IXZnFFsBFiBrfS9CWgFGQFVVAEVGbnonMHJEQVxEWwYYD10PXUJ7LXh6YBJaFBtE"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, ] }, "actions" : [ "actions" : [ { }, } setWarning(pagerId); { // --> "displaySubject" : "true", "linkDisabled" : "false" { "truncateBodyRetainsHtml" : "false", The offer two sets of free public DNS servers, one of which is just for parental controls with dozens of filtering options. "useTruncatedSubject" : "true", '; "action" : "rerender" })(LITHIUM.jQuery); "event" : "unapproveMessage", "context" : "", }, "context" : "envParam:selectedMessage", { { "action" : "pulsate" "actions" : [ }); } "eventActions" : [ { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); { "action" : "rerender" count = 0; "actions" : [ { ] "entity" : "2228729", "}); "useSubjectIcons" : "true", "event" : "unapproveMessage", "useSubjectIcons" : "true", }, "context" : "envParam:quiltName,product,contextId,contextUrl", } "showCountOnly" : "false", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ } "context" : "", "action" : "rerender" }, ] }, ] "dialogKey" : "dialogKey" "context" : "envParam:entity", "message" : "2232483", }); ] "actions" : [ }, count = 0; return; ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "actions" : [ ] "action" : "rerender" "parameters" : { "includeRepliesModerationState" : "false", "actions" : [ "action" : "rerender" }); { ', 'ajax'); ] }, ] "actions" : [ { "forceSearchRequestParameterForBlurbBuilder" : "false", ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2228895 .lia-rating-control-passive', '#form_4'); "displaySubject" : "true", } LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" window.onclick = function(event) { "event" : "kudoEntity", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "", \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_70c9c3396ad065', 'disableAutoComplete', '#ajaxfeedback_70c9c339399659_0', 'LITHIUM:ajaxError', {}, 'TwaF4jACg46aRt0C_Gpnc2i7bLTzMVaj9o-Z2Lw7P2I. "event" : "MessagesWidgetMessageEdit", { "context" : "envParam:quiltName", "action" : "rerender" ] LITHIUM.AjaxSupport.ComponentEvents.set({ "message" : "2233224", } "actions" : [ ] { .attr('aria-expanded','false') $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); }, LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "event" : "MessagesWidgetEditAction", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "deleteMessage",