{ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); if ( key == neededkeys[0] ) { lithstudio: [], "actions" : [ Bist du sicher, dass du fortfahren möchtest? "event" : "deleteMessage", { ] { "useCountToKudo" : "false", "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'p2YnkjBPAVQMszi4hoFWoMAoMfl1iMlzvYQmbtQTjN4. "showCountOnly" : "false", "}); "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "kudoEntity", "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? ] { "buttonDialogCloseAlt" : "Schließen", }, "truncateBodyRetainsHtml" : "false", "event" : "approveMessage", "event" : "unapproveMessage", ] ] "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", { ] } } })(LITHIUM.jQuery); "event" : "QuickReply", "event" : "markAsSpamWithoutRedirect", "action" : "rerender" ] "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "context" : "", "action" : "rerender" "actions" : [ { ] LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, } "action" : "addClassName" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" "actions" : [ $(document).keydown(function(e) { "event" : "MessagesWidgetCommentForm", ] "action" : "rerender" "actions" : [ } "disableKudosForAnonUser" : "false", "event" : "deleteMessage", ] } { "event" : "addThreadUserEmailSubscription", "useSubjectIcons" : "true", { "event" : "ProductAnswer", { }, "dialogContentCssClass" : "lia-panel-dialog-content", ] "actions" : [ "selector" : "#kudosButtonV2_5", { "initiatorDataMatcher" : "data-lia-message-uid" ] { }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '6U-DCT5TyLciQkt8n-YMIOQfwAYWVn5c-We_gGFvNnc. $(event.data.selector).removeClass('cssmenu-open'); } }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1984229 .lia-rating-control-passive', '#form_1'); "context" : "envParam:selectedMessage", "event" : "kudoEntity", }, "componentId" : "kudos.widget.button", ] // Oops. { "context" : "", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "event" : "addMessageUserEmailSubscription", "event" : "kudoEntity", "buttonDialogCloseAlt" : "Schließen", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.Dialog({ "context" : "", { "context" : "envParam:feedbackData", "parameters" : { }, "context" : "envParam:selectedMessage", "event" : "markAsSpamWithoutRedirect", { window.location.replace('/t5/user/userloginpage'); "actions" : [ ], { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "truncateBodyRetainsHtml" : "false", "initiatorBinding" : true, { "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetAnswerForm", }, })(LITHIUM.jQuery); "action" : "rerender" "context" : "", }, "truncateBodyRetainsHtml" : "false", "action" : "pulsate" "forceSearchRequestParameterForBlurbBuilder" : "false", element.addClass('active'); }, ] ] "actions" : [ "action" : "rerender" "event" : "MessagesWidgetEditAction", "action" : "rerender" ] "action" : "rerender" "action" : "rerender" "context" : "", } "event" : "MessagesWidgetEditAction", }, "disableLinks" : "false", "context" : "envParam:selectedMessage", ] // If watching, pay attention to key presses, looking for right sequence. "context" : "", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); } "event" : "expandMessage", }, "initiatorBinding" : true, "useSimpleView" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/20437","ajaxErrorEventName":"LITHIUM:ajaxError","token":"6MvvwYVEpYAP_b2sdS0zzkSeCVi6YjM09fwfgwTaHTc. } LITHIUM.AjaxSupport.ComponentEvents.set({ "displayStyle" : "horizontal", { "revokeMode" : "true", { { "entity" : "1984350", Private Daten erfragen wir bei Bedarf, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_1ed95d54e73864', 'disableAutoComplete', '#ajaxfeedback_1ed95d54c0abbe_0', 'LITHIUM:ajaxError', {}, 'p2Rsfg2DuD5Z48Ua0smN0MF1W97RMk24Uzr71lKmy6A. "forceSearchRequestParameterForBlurbBuilder" : "false", var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); { "event" : "approveMessage", "action" : "addClassName" "eventActions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] ] event.preventDefault(); "action" : "pulsate" } { "context" : "envParam:quiltName", "initiatorBinding" : true, ] })(LITHIUM.jQuery); "kudosable" : "true", "truncateBody" : "true", "eventActions" : [ "kudosLinksDisabled" : "false", "context" : "", { $(this).toggleClass("view-btn-open view-btn-close"); "selector" : "#kudosButtonV2_2", { { } "event" : "editProductMessage", }); "actions" : [ "event" : "RevokeSolutionAction", ] ] "action" : "pulsate" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "context" : "", "actions" : [ "context" : "", "useSubjectIcons" : "true", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", ] "actions" : [ } "context" : "", }, } { { "action" : "rerender" LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); ;(function($) { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "QuickReply", } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] } "action" : "rerender" "event" : "unapproveMessage", "truncateBody" : "true", "event" : "removeThreadUserEmailSubscription", "context" : "", { "context" : "", } else { { "actions" : [ { "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/41519","ajaxErrorEventName":"LITHIUM:ajaxError","token":"m169Q4KKnKMBOwEE6JyHpz45HnNUo8ZXc00jjNcDzLI. }, "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "actions" : [ }, { "actions" : [ "context" : "envParam:quiltName", { "context" : "", { "useCountToKudo" : "false", }, }, "context" : "", "event" : "MessagesWidgetEditAction", }, ;(function($) { "actions" : [ ] } }; "event" : "unapproveMessage", element.find('ul').slideUp(); { November 2019 ist beim iPhone 5 ein iOS-Update erforderlich, um die präzise GPS-Ortung aufrechtzuerhalten und weiterhin Funktionen zu nutzen, die auf dem korrekten Datum und der korrekten Uhrzeit basieren, einschließlich App Store, iCloud, E-Mail und Surfen im Internet. } "action" : "addClassName" "selector" : "#messageview_5", "event" : "kudoEntity", } "initiatorDataMatcher" : "data-lia-message-uid" ] "actions" : [ ] { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'IGBff5PEYG5Qp507weDlgmXGOIEzV06brCGCXn1oDPI. } "action" : "addClassName" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1984491,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" { { { } { { "event" : "ProductAnswerComment", "defaultAriaLabel" : "", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/41519","ajaxErrorEventName":"LITHIUM:ajaxError","token":"M_foCVvJq_UKuzhGRs0gGKalTsr-b0a5ASOfAiA92AY. "quiltName" : "ForumMessage", "event" : "ProductAnswer", }, "context" : "", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ] { } { $(document).ready(function(){ "revokeMode" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ }, "actions" : [ "actions" : [ // --> ', 'ajax'); "event" : "ProductAnswer", "truncateBodyRetainsHtml" : "false", "actions" : [ { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1984229,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] ] { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1983562 .lia-rating-control-passive', '#form'); "actions" : [ { }); "componentId" : "forums.widget.message-view", "revokeMode" : "true", } }); "actions" : [ if ( count == neededkeys.length ) { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } { "linkDisabled" : "false" "useCountToKudo" : "false", "action" : "addClassName" "kudosLinksDisabled" : "false", "event" : "ProductAnswer", "event" : "deleteMessage", }); "action" : "rerender" { "initiatorBinding" : true, "event" : "editProductMessage", } ] "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" { "context" : "lia-deleted-state", } } ] { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "context" : "envParam:quiltName,expandedQuiltName", { } "action" : "rerender" }, "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:quiltName", "action" : "rerender" "actions" : [ "context" : "", { if ( watching ) { "actions" : [ }, { } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ }, } }, "event" : "MessagesWidgetEditAction", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { { "displayStyle" : "horizontal", "parameters" : { "action" : "rerender" "action" : "rerender" ] { Diskutiere Zweites Nexus S nicht kompatibel mit App im Google Nexus S Forum im Bereich Weitere Google Geräte. ] "event" : "MessagesWidgetCommentForm", LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", { resetMenu(); { } "initiatorDataMatcher" : "data-lia-message-uid" if ( !watching ) { }, }, }, } ] { ] "quiltName" : "ForumMessage", "action" : "rerender" "context" : "", "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, "messageViewOptions" : "1111110111111111111110111110100101001101" { "event" : "kudoEntity", "event" : "MessagesWidgetMessageEdit", "actions" : [ "context" : "", "displaySubject" : "true", "actions" : [ } ] { { }, "displayStyle" : "horizontal", var handleClose = function(event) { }, ] "event" : "ProductAnswer", }, "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", count = 0; }, "context" : "", } LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/41519","ajaxErrorEventName":"LITHIUM:ajaxError","token":"4Djucg0MDZ-0k549gqfu1CMS2AEBE8oXVIsbvYz-L1A. }); "messageViewOptions" : "1111110111111111111110111110100101001101" ] { { { } }, ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); ] ] "event" : "ProductAnswerComment", }); "event" : "addThreadUserEmailSubscription", }, } "event" : "MessagesWidgetMessageEdit", } else { "message" : "1339050", ] "context" : "", } ] "actions" : [ "}); ] ] "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); } "event" : "addMessageUserEmailSubscription", { "context" : "envParam:selectedMessage", } ] } }, } ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "event" : "deleteMessage", }, "actions" : [ "componentId" : "kudos.widget.button", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); ] { { } ] { var count = 0; ] "actions" : [ "actions" : [ var msg = $(".message-uid-1985053"); ] } $('div[class*="-menu-btn"]').removeClass('active'); })(LITHIUM.jQuery); ] LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" "actions" : [ "context" : "", "useSimpleView" : "false", { if ( neededkeys[count] == key ) { { } else { { ] LITHIUM.AjaxSupport.ComponentEvents.set({ ] { "event" : "ProductAnswerComment", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "event" : "deleteMessage", "event" : "removeThreadUserEmailSubscription", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'tztdgBljiOizj7BlvdkKGDBlAbjYwePIIyMqnJruoi4. "useSimpleView" : "false", "actions" : [ "action" : "rerender" ], }, "actions" : [ "eventActions" : [ // Reset the conditions so that someone can do it all again.